Biography Tzx
Pedro Cuatrecasas is adjunct professor of Pharmacology and of Medicine at the University of California, San Diego. He received an M.D. from the Washington University School of Medicine, St. Louis. During more than twenty years, he was in charge of research and development at Burroughs Wellcome Co., Glaxo Inc., and Parke Davis Warner Lambert Co. His research interests have included drug discovery, protein chemistry, hormone action, receptor chemistry and signal transduction. Meir Wilchek is a...
B Receptors
B2 receptors mediate bronchoconstriction, local blood flow regulation, hypotension, acute inflammatory reactions, pain, and hyperalgesia. B2 receptors from several species have been cloned. Like B1 receptors, they are typical G protein-coupled receptors in sequence. The human receptor has a predicted sequence of 364 amino acids. Both B1 and B2 receptors are found on chromosome 14 in humans, only about 12 kb apart. Like B1 receptors, B2 receptors activate phosphotidyli-nositol-specific...
Bradykinin Receptors
AlgoRx Pharmaceuticals, Inc., Cranbury, New Jersey, USA Bradykinin is an inflammatory nonapeptide, whose generation in tissues and body fluids elicits numerous physiological effects including vasodilation, edema, smooth muscle contraction, as well as pain and hyperalgesia, by stimulating A- and C-neurons. Bradykinin contributes to inflammatory responses in acute and chronic diseases including allergic reactions, arthritis, asthma, sepsis, viral rhinitis, and inflammatory bowel diseases. Most G...
Bioenergetics General Definition of Principles
Buck Institute for Age Research, Novato, California, USA Bioenergetics is the study of the molecular mechanisms by which energy, made available by catabolic metabolic pathways or by light capture in photosynthesis, is transformed and made available for cellular processes of growth, motility, and survival. Traditionally, the field has largely focused on studies of bacteria, mitochondria, and chloroplasts, although the principles, largely involving the generation and utilization of ion gradients...
Chromatin Dynamics
Recent work has revealed that living nuclei are remarkably dynamic. While the nucleosome core histones are long lived and stably incorporated, histone H1 binds to chromatin with a half-life of a few minutes, and most NHCPs have half-lives of a few seconds. Modeling of chromatin fibers based on thermodynamic principals indicates a constant fluctuation in local compaction. Also, individual clusters of genes may change dramatically in compaction state and even location in the nucleus when...
ABAInduced Modulation of Gene Expression
The synthesis of endogenous ABA increases in response to osmotic stress, which in turn induces numerous stress-associated genes involved in the accumulation of osmo-protectants and LEA proteins, protein turnover, stress signaling pathways, and transcriptional regulation. ABA accumulated in response to osmotic stress is likely to be sensed by a receptor protein sensor , albeit the identity and the location of such a component is yet unknown. The components of ABA signaling involved in...
ABA Biosynthesis
Osmotic stress induction of ABA accumulation is a complex signaling process from the initial water-stress perception, intracellular signal transduction, to gene expression or activation of the enzymes involved in the ABA biosynthesis. The chain of events from the perception of osmotic stress to the gene activation leading to ABA biosynthesis is unknown. Presumably, it involves reactive oxygen species ROS calcium signaling and protein phosphorylation cascades. Significant progress has been made...
Chemiosmotic Theory
Portland State University, Portland, Oregon, USA Mitochondria transform the chemical energy derived from food and body stores into ATP by a process called oxidative phosphorylation. The chemiosmotic theory begins by describing the mechanism of coupling between substrate oxidation and phosphorylation. It goes on to describe the membrane properties that are required in order for mitochondria to provide ATP to the cell and, indeed, to survive within the cell. The chemiosmotic theory was presented...
Ct 1
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP -amide FIGURE 1 The CT peptide family. The peptides share a six seven amino acid ring structure, formed by a disulphide bridge at or close to the N terminus. The peptides also have C-terminal amides, which are essential for full biological activity. This material is from Calcitonin Gene-related Peptide CGRP , Girgis, S. I., and MacIntyre, I. 2002 . In Encyclopedia of Molecular Medicine T.E. Creighton ed. , Vol. 5, John Wiley amp Sons Inc. FIGURE 1 The CT peptide...
Biography Gls
David B. Bylund is a professor and former chair of the Department of Pharmacology at the University of Nebraska Medical Center in Omaha, Nebraska. His main research interests are related to the regulation of adrenergic receptors and their role in mental disorders. He received his Ph.D. from the University of California at Davis and was a postdoctoral fellow at Johns Hopkins University. He was President of the American Society for Pharmacology and Experimental Therapeutics for 2003-2004.
Adp 1
FIGURE 4 The alternating catalytic sites hypothesis for P-glyco-protein, according to Alan Senior. The NBDs have three ligands and four states free, ATP bound, ADP Pi bound, and ADP bound. They alternate in such a way that two ATPs never bind simultaneously. The binding of one ATP to one NBD induces hydrolysis at the other ATP. The drug is transported out during Pi release. related to the TMDs through four distinct stalks. Each NBD is oriented at a fixed 90 angle relative to its neighbor NBDs....
Cadherin Signaling
David B. Sacks and Jonathan M.G. Higgins Brigham and Women's Hospital and Harvard Medical School, Boston, Massachusetts, USA The associations of cells with one another regulate many cellular processes. Adherens junctions are specialized adhesive structures between cells that are formed by cadherin-dependent interactions. Cadherins are a family of Ca2 -dependent intercellular adhesion molecules linked to the cytoskeleton. Cadherins are also signaling molecules that convey information from the...